PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G000300.1.p
Common NameGLYMA_16G000300, LOC100819023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 666aa    MW: 74193.4 Da    PI: 5.807
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G000300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.42.3e-22118218198
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f+k+lt sd++++g +++ +++a+++       ++++ +  +l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F 
  Glyma.16G000300.1.p 118 FCKTLTASDTSTHGGFSVLRRHADDClppldmtQQPPWQ--ELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL 205
                          99****************************975444444..8************************************************ PP

                          E-SSSEE..EEEEE- CS
                   B3  84 ldgrsefelvvkvfr 98 
                            + +++el+v+v+r
  Glyma.16G000300.1.p 206 --RGENGELRVGVRR 218
                          ..449999*****97 PP

2Auxin_resp112.63.8e-37244326183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++t++ F+v+Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm+fe+++++err+sGt+vgv+d +++ W +S+WrsLk
  Glyma.16G000300.1.p 244 ASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPERRFSGTIVGVEDNKSLVWADSEWRSLK 326
                          789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-43109247IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-40110233IPR015300DNA-binding pseudobarrel domain
CDDcd100178.18E-21116218No hitNo description
PfamPF023624.2E-20118218IPR003340B3 DNA binding domain
PROSITE profilePS5086311.251118220IPR003340B3 DNA binding domain
SMARTSM010191.2E-21118220IPR003340B3 DNA binding domain
PfamPF065075.9E-35244326IPR010525Auxin response factor
PfamPF023094.6E-12538631IPR033389AUX/IAA domain
PROSITE profilePS5174527.147541634IPR000270PB1 domain
SuperFamilySSF542771.84E-11543618No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MASAAPGATN DALYKELWHA CAGPLVTLPR EGERVYYFPQ GHMEQLEASM NQGLEQQMPS  60
FNLPSKILCK VVNVHLRAEP ETDEVYAQIT LLPEADQSEV TSPDDPLPES PRCTVHSFCK  120
TLTASDTSTH GGFSVLRRHA DDCLPPLDMT QQPPWQELVA TDLHGNEWHF RHIFRGQPRR  180
HLLTTGWSVF VSSKKLVAGD AFIFLRGENG ELRVGVRRLM RQHSNMPSSV ISSHSMHLGV  240
LATASHAIAT GTLFSVFYKP RTSRSEFIVS VNKYLEAQSH KLSVGMRFKM RFEGDEVPER  300
RFSGTIVGVE DNKSLVWADS EWRSLKVQWD EPSSILRPDR VSPWELEPLV SNPPTNSQPS  360
QRNKRSRPPI LPSTMLDSSL QGVWKSPVES APFSYRDHQH GRDVYPSTNF NSTATGFLGF  420
GGNCSASNKS IYWSSRIENS TESFSPVAVK EFGEKRQGTA NGCRLFGIQL HDNSNSNEES  480
LPMVSLSGRV GDDGLLPSLD AESDQHSEPS NVNRSDFPSV SCDAEKSCLR SPQESQSRQI  540
RSCTKVHMQG MAVGRAVDLT RFDGYEDLLR KLEEMFDING ELCGSTKEWQ VVYTDNEDDM  600
MMVGDDPWLE FCSIVRKIFI YTAEEVKKLS PKIGLPISEE VKPCKMDSEA VVNPGDQSSI  660
LGPGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.0735113357Auxin response factor 1
4ldw_A0.0735113357Auxin response factor 1
4ldw_B0.0735113357Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.620810.0leaf| somatic embryo
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548301.10.0PREDICTED: auxin response factor 1-like isoform X1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLI1MJS60.0I1MJS6_SOYBN; Auxin response factor
STRINGGLYMA16G00220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1